Molecular Weight: 4380.85Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu-OH (Cys-7-Cys15, Cys17-Cys27, Cys22-Cys38)Sequence (1-letter): APRLPQCQGDDQEKCLCNKDECPPGQCRFPRGDADPYCE-OHStorage: -20 °C or below
Decorsin is a peptide isolated from the North American leech Macrobdella decora. It is a potent inhibitor of platelet aggregation by acting as an antagonist of platelet glycoprotein IIb-IIIa (GPIIb-IIIa) (IC50 = 1.5 nM).
Seymour JL, Henzel WJ, Nevins B, Stults JT, Lazarus RA. Decorsin. A potent glycoprotein IIb-IIIa antagonist and platelet aggregation inhibitor from the leech Macrobdella decora. J Biol Chem. 1990 Jun 15;265(17):10143-7. PMID: 2351655.
| Categories | Peptides |
|---|---|
| Filter | Inhibitor |

