
CAS Number: 61214-51-5Molecular Weight: 3465.05Salt Form: TFAPurity: >95%Sequence (3-letter): Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OHSequence (1-letter): YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OHStorage: -20 °C or below
Beta Lipotropin (61-91) is a precusor for Beta Endorphin, an endogenous neuropeptide which acts as an agonist for opioid receptors. Beta Endorphin binds strongly to μ receptors in brain and by μ and κ receptors in the spinal cord and is released in response to painful stimuli and is studied for its effects on pain perception (nociception). It is found in the hypothalmus and pituitary gland and is formed by cleavage of the C-terminal region of β-lipotropin.
Categories | Peptides |
---|---|
Filter | Neuropeptides & Hormones |