![Echelon/Beta Amyloid (1-40), human [Gly22] (Arctic mutation)/1 mg/641-14](https://www.ebiomall.cn/images/echelon/641-14-Beta-Amyloid-1-40-human-Gly22-Arctic-mutation.jpg)
CAS Number: 175010-18-1Molecular Weight: 4255.16Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV-OHStorage: -20 °C or below
Beta Amyloid (1-40), human [Gly22] (Arctic mutation) causes early onset of Alzheimer′s compared to wild type and promotes protofibril formation and neurotoxicity. Beta amyloid (1-40), along with beta amyloid (1-42) (catalog # 641-15) is one of the two main variants of the amyloid β peptide involved in Alzheimer’s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer’s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models.
Categories | Peptides |
---|---|
Filter | Alzheimer's, Central Nervous System |