CAS Number: 123583-37-9Molecular Weight: 4047.08Salt Form: TFAPurity: >95%Sequence (3-letter): Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2Sequence (1-letter): IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2Storage: -20 °C or belowSolubility: water >1 mg/mL

PYY/Peptide YY (3-36), human is a peptide released by cells in the ileum and colon in response to eating that acts to reduce hunger. PYY acts as a hormonal signal from the gut to the brain to inhibit food intake and promote satiety. Low levels of PYY may be a contributing factor in obesity and binge eating, while elevated levels may contribute to anorexia nervosa and decreased bone turnover.

References

1. Grandt, D., et al. (1994) “Two molecular forms of peptide YY (PYY) are abundant in human blood: characterization of a radioimmunoassay recognizing PYY 1-36 and PYY 3-36.” Regul Pept 51 (2): 151-1592. Chelikani, P.K., Haver, A.C. and Reidelberger, R.D. (2005) “Intravenous infusion of peptide YY (3-36) potently inhibits food intake in rats” Endocrinology 146 (2): 879-888.3. Batterham, R.L., et al. (2003) “Inhibition of food intake in obese subjects by peptide YY3-36” N. Engl. J. Med. 349 (10): 941-9484