CAS Number: 195262-56-7Molecular Weight: 3793.84Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OHSequence (1-letter): HADGSFSDEMNTILDNLATRDFINWLIQTKITD-OHStorage: -20 °C or below
Glucagon-like peptide-2 (GLP-2, Preproglucagon (126-158)) is a 33 amino acid peptide which is formed by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced in gut endocrine cells and certain neuronal cells in the central nervous system. Administration of GLP-2 demos demonstrates cytoprotective and reparative effects in rodent models of intestinal injury. An analog of Glucagon-like peptide-2, Teduglutide, is used as a treatment for short-bowel syndrome by increasing nutrient absorption.
| Categories | Peptides |
|---|---|
| Filter | Gastrointestinal, Neuropeptides & Hormones |

