CAS Number: 99658-04-5Molecular Weight: 4109.02Salt Form: TFAPurity: >95%Sequence (3-letter): His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2Sequence (1-letter): HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2Storage: -20 °C or below
Glucagon-like peptide-1 (GLP-1, Preproglucagon 72-107) is an incretin produced primarily in ileal L cells. GLP-1 secretion by these cells is dependent on the presence of nutrients in the lumen of the small intestine. GLP-1 promotes satiety and sustained GLP-1-receptor activation correlates with weight loss. The biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36)NH2 (cat # 471-39 and 471-28, respectively) which are produced as a result of selective cleavage of proglucagon.
| Categories | Peptides |
|---|---|
| Filter | Metabolic / Diabetes, Neuropeptides & Hormones |
