![Echelon/GLP 2 [Tyr34] (1-34), human/1 mg/471-19](https://www.ebiomall.cn/images/echelon/471-19.jpg)
Molecular Weight: 3926.89Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Tyr-OHSequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITDY-OHStorage: -20 °C or below
Glucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. This analog of GLP-2 with a C-terminal Tyr can be iodinated with 125I and used as a tracer.
| Categories | Peptides |
|---|---|
| Filter | Gastrointestinal, Neuropeptides & Hormones |
